Home
Providers
MODIVO
MODIVO
MODIVO is a Polish multibrand fashion and lifestyle retailer that operates one of the largest fashion e-commerce platforms in Central and Eastern Europe, selling clothing, footwear, accessories, beauty and home products from more than a thousand brands across Poland, the Czech Republic, Slovakia, Romania, Hungary, Ukraine, the Baltics and Western Europe. MODIVO S.A. is the listed parent of the former CCC Group (renamed MODIVO S.A. in February 2026) and the group behind the eobuwie.pl, CCC, HalfPrice, worldbox and DeeZee retail brands; the MODIVO storefront company itself is the former eobuwie.pl S.A., a consumer-technology investment of SoftBank Vision Fund. MODIVO does not run a developer portal, but its storefront is an Adobe Commerce (Magento 2.4) deployment that serves two live, publicly readable machine contracts from its own domain: a self-describing Swagger 2.0 REST schema at https://modivo.pl/rest/all/schema?services=all and an openly introspectable GraphQL endpoint at https://modivo.pl/graphql. Third-party sellers integrate through a Mirakl-hosted marketplace tenant, and brands buy sponsored placements through MODIVO Ads, the group's retail-media platform spanning MODIVO and eobuwie.
MODIVO publishes 37 APIs on the APIs.io network, including Catalog Product Render List V1 API, Chatbot Order Rest API Order Rest API Service V1 API, Checkout Guest Payment Information Management V1 API, and 34 more. Tagged areas include Company, Consumer, Fashion, E-Commerce, and Retail.
The MODIVO catalog on APIs.io includes 1 event-driven AsyncAPI specification.
MODIVO’s developer surface includes support, signup flow, engineering blog, authentication, and 24 more developer resources.
4 APIs
On this page
Kin Score
APIs 37
Open Collections 2
Pricing Plans 1
Rate Limits 1
Event Specs 1
Security Posture 2
Resources 28
apis.yml
Business capabilities this provider's published APIs can perform, derived from its own
contracts. Browse all capabilities →
8 Operational Transparency
28 Create-or-Update Ergonomics
Composite quality — 40.3/100 · developing
Agent readiness — 27/100 · agent aware
Individual APIs this provider publishes, each with its own machine-readable definition.
Scroll for all 37
Open, tool-agnostic API collections (OpenAPI-derived and Bruno).
Published pricing tiers and plan structures.
Documented rate limits and quota policies.
AsyncAPI definitions for this provider's event-driven and streaming APIs.
Authentication, domain security, vulnerability disclosure, and trust-center signals.
Get Started 2
Portal, sign-up, and the first successful call
Agent Surfaces 2
MCP servers, agent skills, and machine-readable catalogs
Design & Contract 6
Pagination, idempotency, versioning, errors, and events
Build 1
SDKs, sample code, and the tooling you integrate with
Access & Security 2
Authentication, authorization, and security posture
Operate 3
Status, limits, changes, and where to get help
Commercial 3
Pricing, plans, and the legal terms of use
Company 4
The organization behind the API
Other 5
Properties that don't map to a standard resource type
Source (apis.yml)
aid: modivo
name: MODIVO
description: 'MODIVO is a Polish multibrand fashion and lifestyle retailer that operates one of the largest fashion e-commerce
platforms in Central and Eastern Europe, selling clothing, footwear, accessories, beauty and home products from more than
a thousand brands across Poland, the Czech Republic, Slovakia, Romania, Hungary, Ukraine, the Baltics and Western Europe.
MODIVO S.A. is the listed parent of the former CCC Group (renamed MODIVO S.A. in February 2026) and the group behind the
eobuwie.pl, CCC, HalfPrice, worldbox and DeeZee retail brands; the MODIVO storefront company itself is the former eobuwie.pl
S.A., a consumer-technology investment of SoftBank Vision Fund. MODIVO does not run a developer portal, but its storefront
is an Adobe Commerce (Magento 2.4) deployment that serves two live, publicly readable machine contracts from its own domain:
a self-describing Swagger 2.0 REST schema at https://modivo.pl/rest/all/schema?services=all and an openly introspectable
GraphQL endpoint at https://modivo.pl/graphql. Third-party sellers integrate through a Mirakl-hosted marketplace tenant,
and brands buy sponsored placements through MODIVO Ads, the group''s retail-media platform spanning MODIVO and eobuwie.'
deliveryModel:
model: saas
open_source: false
commercial: true
callable_host: true
label: Hosted service · you call their endpoint
confidence: high
source:
- openapi
- pricing
generated: '2026-08-28'
method: derived
accessModel:
pricing: unknown
onboarding: none
trial: false
try_now: false
public: true
label: Public storefront commerce API, no developer program
confidence: medium
source:
- authentication
- openapi
generated: '2026-08-12'
method: derived
image: https://kinlane-images.s3.amazonaws.com/shared/apis-json/icons/modivo.png
url: https://raw.githubusercontent.com/api-evangelist/modivo/refs/heads/main/apis.yml
x-type: company
x-source: vc-portfolio
x-backed-by:
- softbank-vision-fund
specificationVersion: '0.23'
created: '2026-07-17'
modified: '2026-09-16'
tags:
- Company
- Consumer
- Fashion
- E-Commerce
- Retail
- Marketplace
- Retail Media
- Commerce
- Checkout
- Catalog
- GraphQL
- Adobe Commerce
- Magento
- Poland
- Central Europe
apis:
- name: MODIVO Storefront GraphQL API
description: 'The GraphQL endpoint that powers the MODIVO storefront and mobile applications, exposed at https://modivo.pl/graphql
with introspection left open to anonymous callers. The schema carries 770 types, 111 root query fields and 134 root mutation
fields — the Adobe Commerce storefront schema plus a large set of MODIVO extensions: marketplace cart and offer handling,
MODIVO club and loyalty, returns and RMA flows, product reviews, DPD and InPost parcel-shop lookup, store pickup places,
GDPR consent management, app deep links and CMS content elements, and a wide payment surface (Braintree, PayPal, Klarna,
PayU virtual bank accounts, vaulted cards). Authentication is a customer bearer token minted by generateCustomerToken
and its social variants; unauthenticated access is limited to catalog, CMS, directory and guest-cart fields.'
humanURL: https://modivo.pl/graphql
baseURL: https://modivo.pl/graphql
tags:
- GraphQL
- E-Commerce
- Commerce
- Checkout
- Catalog
- Retail
- Marketplace
- Adobe Commerce
properties:
- type: GraphQL
url: graphql/modivo-storefront.graphql
- type: GraphQL
url: https://modivo.pl/graphql
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ToolCrosswalk
url: mcp/modivo-tool-crosswalk.yml
- name: MODIVO Marketplace Seller API (Mirakl)
description: 'MODIVO''s third-party marketplace runs on a Mirakl tenant at modivo.mirakl.net. Sellers automate offers, stock,
prices, orders and tracking numbers through the standard Mirakl Marketplace Seller API on that host. The tenant is closed:
the console 302s to Mirakl SSO, /api/documentation and /api/openapi.json both return HTTP 401, and robots.txt disallows
/api/. No MODIVO-published contract is available for this surface, so none is recorded here — only the probed evidence
that it exists and is gated.'
humanURL: https://modivo.mirakl.net/
baseURL: https://modivo.mirakl.net/api
tags:
- Marketplace
- E-Commerce
- Retail
- Commerce
properties:
- type: Documentation
url: https://modivo.mirakl.net/
- type: Conformance
url: conformance/modivo-conformance.yml
- aid: modivo:modivo-catalogproductrenderlistv1-api
name: MODIVO Catalog Product Render List V1 API
description: Interface which provides product renders information for products.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- catalogProductRenderListV1
properties:
- type: OpenAPI
url: openapi/modivo-catalogproductrenderlistv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-chatbotorderrestapiorderrestapiservicev1-api
name: MODIVO Chatbot Order Rest API Order Rest API Service V1 API
description: The chatbotOrderRestApiOrderRestApiServiceV1 API from MODIVO — 2 operation(s) for chatbotorderrestapiorderrestapiservicev1.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- chatbotOrderRestApiOrderRestApiServiceV1
properties:
- type: OpenAPI
url: openapi/modivo-chatbotorderrestapiorderrestapiservicev1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-checkoutguestpaymentinformationmanagementv1-api
name: MODIVO Checkout Guest Payment Information Management V1 API
description: Interface for managing guest payment information
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- checkoutGuestPaymentInformationManagementV1
properties:
- type: OpenAPI
url: openapi/modivo-checkoutguestpaymentinformationmanagementv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-checkoutguestshippinginformationmanagementv1-api
name: MODIVO Checkout Guest Shipping Information Management V1 API
description: Interface for managing guest shipping address information
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- checkoutGuestShippingInformationManagementV1
properties:
- type: OpenAPI
url: openapi/modivo-checkoutguestshippinginformationmanagementv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-checkoutguesttotalsinformationmanagementv1-api
name: MODIVO Checkout Guest Totals Information Management V1 API
description: Interface for guest quote totals calculation
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- checkoutGuestTotalsInformationManagementV1
properties:
- type: OpenAPI
url: openapi/modivo-checkoutguesttotalsinformationmanagementv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-customeraccountmanagementv1-api
name: MODIVO Customer Account Management V1 API
description: Interface for managing customers accounts.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- customerAccountManagementV1
properties:
- type: OpenAPI
url: openapi/modivo-customeraccountmanagementv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-directorycountryinformationacquirerv1-api
name: MODIVO Directory Country Information Acquirer V1 API
description: Country information acquirer interface
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- directoryCountryInformationAcquirerV1
properties:
- type: OpenAPI
url: openapi/modivo-directorycountryinformationacquirerv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-directorycurrencyinformationacquirerv1-api
name: MODIVO Directory Currency Information Acquirer V1 API
description: Currency information acquirer interface
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- directoryCurrencyInformationAcquirerV1
properties:
- type: OpenAPI
url: openapi/modivo-directorycurrencyinformationacquirerv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-eobjwthttpservicev1-api
name: MODIVO Eob JWT HTTP Service V1 API
description: Interface HttpServiceInterface
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- eobJWTHttpServiceV1
properties:
- type: OpenAPI
url: openapi/modivo-eobjwthttpservicev1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-eobmyreturnswebhookwebhookv1-api
name: MODIVO Eob My Returns Webhook V1 API
description: The eobMyReturnsWebhookWebhookV1 API from MODIVO — 1 operation(s) for eobmyreturnswebhookwebhookv1.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- eobMyReturnsWebhookWebhookV1
properties:
- type: OpenAPI
url: openapi/modivo-eobmyreturnswebhookwebhookv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-eobplaceorderordermanagementv1-api
name: MODIVO Eob Place Order Management V1 API
description: The eobPlaceOrderOrderManagementV1 API from MODIVO — 1 operation(s) for eobplaceorderordermanagementv1.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- eobPlaceOrderOrderManagementV1
properties:
- type: OpenAPI
url: openapi/modivo-eobplaceorderordermanagementv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-eobtrustmateintegrationdisplayapiv1-api
name: MODIVO Eob Trustmate Integration Display API V1 API
description: The eobTrustmateIntegrationDisplayApiV1 API from MODIVO — 1 operation(s) for eobtrustmateintegrationdisplayapiv1.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- eobTrustmateIntegrationDisplayApiV1
properties:
- type: OpenAPI
url: openapi/modivo-eobtrustmateintegrationdisplayapiv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-giftmessageguestcartrepositoryv1-api
name: MODIVO Gift Message Guest Cart Repository V1 API
description: Interface GuestCartRepositoryInterface
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- giftMessageGuestCartRepositoryV1
properties:
- type: OpenAPI
url: openapi/modivo-giftmessageguestcartrepositoryv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-giftmessageguestitemrepositoryv1-api
name: MODIVO Gift Message Guest Item Repository V1 API
description: Interface GuestItemRepositoryInterface
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- giftMessageGuestItemRepositoryV1
properties:
- type: OpenAPI
url: openapi/modivo-giftmessageguestitemrepositoryv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-integrationadmintokenservicev1-api
name: MODIVO Integration Admin Token Service V1 API
description: Interface providing token generation for Admins
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- integrationAdminTokenServiceV1
properties:
- type: OpenAPI
url: openapi/modivo-integrationadmintokenservicev1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-integrationcustomertokenservicev1-api
name: MODIVO Integration Customer Token Service V1 API
description: Interface providing token generation for Customers
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- integrationCustomerTokenServiceV1
properties:
- type: OpenAPI
url: openapi/modivo-integrationcustomertokenservicev1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-inventoryinstorepickupapigetpickuplocationsv1-api
name: MODIVO Inventory In Store Pickup API Get Pickup Locations V1 API
description: Get Pickup Locations filtered by provided Search Request. Pickup Location entities are Immutable object and
can not be changed after creation. All modification of Pickup Location must be done through @see \Magento\InventoryApi\Api\SourceRepositoryInterface
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- inventoryInStorePickupApiGetPickupLocationsV1
properties:
- type: OpenAPI
url: openapi/modivo-inventoryinstorepickupapigetpickuplocationsv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-marketplaceplaceorderordermanagementv1-api
name: MODIVO Marketplace Place Order Management V1 API
description: The marketplacePlaceOrderOrderManagementV1 API from MODIVO — 1 operation(s) for marketplaceplaceorderordermanagementv1.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- marketplacePlaceOrderOrderManagementV1
properties:
- type: OpenAPI
url: openapi/modivo-marketplaceplaceorderordermanagementv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-modivomyreturnswebhookwebhookv1-api
name: MODIVO My Returns Webhook V1 API
description: The modivoMyReturnsWebhookWebhookV1 API from MODIVO — 1 operation(s) for modivomyreturnswebhookwebhookv1.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- modivoMyReturnsWebhookWebhookV1
properties:
- type: OpenAPI
url: openapi/modivo-modivomyreturnswebhookwebhookv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-paymentservicespaypalcompleteorderv1-api
name: MODIVO Payment Services Paypal Complete Order V1 API
description: The paymentServicesPaypalCompleteOrderV1 API from MODIVO — 1 operation(s) for paymentservicespaypalcompleteorderv1.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- paymentServicesPaypalCompleteOrderV1
properties:
- type: OpenAPI
url: openapi/modivo-paymentservicespaypalcompleteorderv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-paymentservicespaypalpaymentconfigrequestv1-api
name: MODIVO Payment Services Paypal Payment Config Request V1 API
description: The paymentServicesPaypalPaymentConfigRequestV1 API from MODIVO — 5 operation(s) for paymentservicespaypalpaymentconfigrequestv1.
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- paymentServicesPaypalPaymentConfigRequestV1
properties:
- type: OpenAPI
url: openapi/modivo-paymentservicespaypalpaymentconfigrequestv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-paymentservicespaypalpaymentorderrequestv1-api
name: MODIVO Payment Services Paypal Payment Order Request V1 API
description: An interface for the REST WebAPI request to create an order
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- paymentServicesPaypalPaymentOrderRequestV1
properties:
- type: OpenAPI
url: openapi/modivo-paymentservicespaypalpaymentorderrequestv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-paymentservicespaypalpaymentsdkrequestv1-api
name: MODIVO Payment Services Paypal Payment SDK Request V1 API
description: An interface for the REST WebAPI to get payment sdk urls
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- paymentServicesPaypalPaymentSdkRequestV1
properties:
- type: OpenAPI
url: openapi/modivo-paymentservicespaypalpaymentsdkrequestv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
- type: Swagger
url: openapi/_original/modivo-eobuwie-rest-schema-swagger.json
- type: APIReference
url: https://eobuwie.com.pl/rest/all/schema?services=all
- aid: modivo:modivo-paypalbraintreeauthv1-api
name: MODIVO Pay Pal Braintree Auth V1 API
description: Interface AuthInterface
humanURL: https://modivo.pl/rest/all/schema?services=all
baseURL: https://modivo.pl/rest/all
tags:
- payPalBraintreeAuthV1
properties:
- type: OpenAPI
url: openapi/modivo-paypalbraintreeauthv1-api-openapi.yml
- type: Swagger
url: openapi/_original/modivo-rest-schema-swagger.json
- type: APIReference
url: https://modivo.pl/rest/all/schema?services=all
- type: Authentication
url: authentication/modivo-authentication.yml
- type: Conventions
url: conventions/modivo-conventions.yml
- type: ErrorCatalog
url: errors/modivo-problem-types.yml
- type: DataModel
url: data-model/modivo-data-model.yml
- type: RateLimits
url: rate-limits/modivo-rate-limits.yml
- type: Webhooks
url: asyncapi/modivo-webhooks.yml
# --- truncated at 32 KB (46 KB total) ---
# Full source: https://raw.githubusercontent.com/api-evangelist/modivo/refs/heads/main/apis.yml
Every provider here is available over the APIs.io API and to AI agents over MCP.
MCP server
One button, every client — Claude, Cursor, VS Code and the rest.
https://apis.io/mcp
Tools for providers
9 MCP tools reach this
find_providersBrowse and filter every provider in the catalog.
get_provider_artifactsEvery artifact this provider publishes, grouped by type.
get_provider_operationsEvery operation across all of their OpenAPIs — one call instead of parsing every spec.
get_provider_toolsEvery MCP tool they ship, with the operation each wraps.
get_provider_evidenceHow each part of their score was established. Free — the basis for a claim should not sit behind it.
get_provider_ratingPRO — composite, band, trend and facet scores.
apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.
resolveTurn a domain, URL or GitHub org into the provider it belongs to.
find_cohortsEvery scored population of providers in the catalog.
All 92 tools →
Call it yourself
curl for this page
This provider
curl "https://apis.io/api/v1/providers/modivo"
All providers
curl "https://apis.io/api/v1/providers?limit=25"
Every operation they expose
curl "https://apis.io/api/v1/providers/modivo/operations?limit=25"
How their score was established
curl "https://apis.io/api/v1/providers/modivo/evidence"
Discovery needs no key. Ratings and market analysis are Pro.
Get an API key
Free tier, no form to fill in. Signing in shares your email address with us — we
store it to create your key and to recognise you if you sign in with another
provider. See our Privacy Policy and
Terms .
A second provider on the same verified email joins the account you already have.