Microsoft Graph · Schema

microsoft.graph.riskyServicePrincipalHistoryItem

Azure ADCollaborationContactsDocumentsEmailGraphIdentityMicrosoftOffice 365PresentationsProductivitySpreadsheetsT1Task
View JSON Schema on GitHub

JSON Schema

microsoft-graph-microsoftgraphriskyserviceprincipalhistoryitem-schema.json Raw ↑
{
  "$schema": "https://json-schema.org/draft/2020-12/schema",
  "$id": "#/components/schemas/microsoft.graph.riskyServicePrincipalHistoryItem",
  "title": "microsoft.graph.riskyServicePrincipalHistoryItem",
  "allOf": [
    {
      "$ref": "#/components/schemas/microsoft.graph.riskyServicePrincipal"
    },
    {
      "title": "riskyServicePrincipalHistoryItem",
      "required": [
        "@odata.type"
      ],
      "type": "object",
      "properties": {
        "activity": {
          "anyOf": [
            {
              "$ref": "#/components/schemas/microsoft.graph.riskServicePrincipalActivity"
            },
            {
              "type": "object",
              "nullable": true
            }
          ],
          "description": "The activity related to service principal risk level change."
        },
        "initiatedBy": {
          "type": "string",
          "description": "The identifier of the actor of the operation.",
          "nullable": true
        },
        "@odata.type": {
          "type": "string"
        }
      }
    }
  ],
  "x-ms-discriminator-value": "#microsoft.graph.riskyServicePrincipalHistoryItem"
}

Work with this as data

Every JSON Schema here is available over the APIs.io API and to AI agents over MCP.

MCP server

One button, every client — Claude, Cursor, VS Code and the rest.

https://apis.io/mcp

Tools for schemas

4 MCP tools reach this
  • find_json_schemasBrowse and filter every JSON Schema in the catalog.
  • apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.
  • resolveTurn a domain, URL or GitHub org into the provider it belongs to.
  • find_cohortsEvery scored population of providers in the catalog.
All 92 tools →

Call it yourself

curl for this page
This JSON Schema
curl "https://apis.io/api/v1/json-schemas/microsoft-graph-microsoftgraphriskyserviceprincipalhistoryitem"
All schemas
curl "https://apis.io/api/v1/json-schemas?limit=25"

Discovery needs no key. Ratings and market analysis are Pro.

Get an API key

Free tier, no form to fill in. Signing in shares your email address with us — we store it to create your key and to recognise you if you sign in with another provider. See our Privacy Policy and Terms.

A second provider on the same verified email joins the account you already have.