Microsoft Graph · Schema

riskServicePrincipalActivity

Microsoft GraphAzure ADCollaborationContactsDocumentsEmailGraphIdentityMicrosoftOffice 365PresentationsProductivitySpreadsheetsT1Task

Properties

Name Type Description
detail object Details of the detected risk. Note: Details for this property are only available for Workload Identities Premium customers. Events in tenants without this license will be returned hidden.
riskEventTypes array The type of risk event detected. The possible values are: investigationsThreatIntelligence, generic, adminConfirmedServicePrincipalCompromised, suspiciousSignins, leakedCredentials, anomalousServicePr
@odata.type string
View JSON Schema on GitHub

JSON Schema

microsoft-graph-microsoftgraphriskserviceprincipalactivity-schema.json Raw ↑
{
  "$schema": "https://json-schema.org/draft/2020-12/schema",
  "$id": "#/components/schemas/microsoft.graph.riskServicePrincipalActivity",
  "title": "riskServicePrincipalActivity",
  "required": [
    "@odata.type"
  ],
  "type": "object",
  "properties": {
    "detail": {
      "anyOf": [
        {
          "$ref": "#/components/schemas/microsoft.graph.riskDetail"
        },
        {
          "type": "object",
          "nullable": true
        }
      ],
      "description": "Details of the detected risk. Note: Details for this property are only available for Workload Identities Premium customers. Events in tenants without this license will be returned hidden."
    },
    "riskEventTypes": {
      "type": "array",
      "items": {
        "type": "string",
        "nullable": true
      },
      "description": "The type of risk event detected. The possible values are: investigationsThreatIntelligence, generic, adminConfirmedServicePrincipalCompromised, suspiciousSignins, leakedCredentials, anomalousServicePrincipalActivity, maliciousApplication, suspiciousApplication."
    },
    "@odata.type": {
      "type": "string"
    }
  }
}

Work with this as data

Every JSON Schema here is available over the APIs.io API and to AI agents over MCP.

MCP server

One button, every client — Claude, Cursor, VS Code and the rest.

https://apis.io/mcp

Tools for schemas

4 MCP tools reach this
  • find_json_schemasBrowse and filter every JSON Schema in the catalog.
  • apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.
  • resolveTurn a domain, URL or GitHub org into the provider it belongs to.
  • find_cohortsEvery scored population of providers in the catalog.
All 92 tools →

Call it yourself

curl for this page
This JSON Schema
curl "https://apis.io/api/v1/json-schemas/microsoft-graph-microsoftgraphriskserviceprincipalactivity"
All schemas
curl "https://apis.io/api/v1/json-schemas?limit=25"

Discovery needs no key. Ratings and market analysis are Pro.

Get an API key

Free tier, no form to fill in. Signing in shares your email address with us — we store it to create your key and to recognise you if you sign in with another provider. See our Privacy Policy and Terms.

A second provider on the same verified email joins the account you already have.