Kong · Schema

Filter by gateway_service

KongAPI GatewayAI GatewayAI ConnectivityAgent GatewayEvent GatewayMCP RegistryService MeshLLMKafkaKonnectOpen Source
View JSON Schema on GitHub

JSON Schema

kong-metricsgatewayservicefilterbyfield-schema.json Raw ↑
{
  "$schema": "https://json-schema.org/draft/2020-12/schema",
  "$id": "#/components/schemas/MetricsGatewayServiceFilterByField",
  "title": "Filter by gateway_service",
  "oneOf": [
    {
      "title": "Multiselect filters",
      "type": "object",
      "properties": {
        "operator": {
          "$ref": "#/components/schemas/RequestsFilterType"
        },
        "value": {
          "description": "The IDs to include in the results. Because gateway IDs are only unique within a given control plane, the filter values must be of the form `control_plane_id:field_id` or `control_plane_group_id:field_id` for data plane nodes within a control plane group.\n",
          "type": "array",
          "items": {
            "$ref": "#/components/schemas/ScopedUuid"
          }
        },
        "field": {
          "description": "The field to filter.",
          "type": "string",
          "enum": [
            "gateway_service"
          ]
        }
      },
      "required": [
        "operator",
        "value",
        "field"
      ]
    },
    {
      "title": "Empty filters",
      "type": "object",
      "properties": {
        "operator": {
          "$ref": "#/components/schemas/RequestsFilterTypeEmpty"
        },
        "field": {
          "description": "The field to filter.",
          "type": "string",
          "enum": [
            "gateway_service"
          ]
        }
      },
      "required": [
        "operator",
        "field"
      ]
    }
  ]
}

Work with this as data

Every JSON Schema here is available over the APIs.io API and to AI agents over MCP.

MCP server

One button, every client — Claude, Cursor, VS Code and the rest.

https://apis.io/mcp

Tools for schemas

4 MCP tools reach this
  • find_json_schemasBrowse and filter every JSON Schema in the catalog.
  • apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.
  • resolveTurn a domain, URL or GitHub org into the provider it belongs to.
  • find_cohortsEvery scored population of providers in the catalog.
All 92 tools →

Call it yourself

curl for this page
This JSON Schema
curl "https://apis.io/api/v1/json-schemas/kong-metricsgatewayservicefilterbyfield"
All schemas
curl "https://apis.io/api/v1/json-schemas?limit=25"

Discovery needs no key. Ratings and market analysis are Pro.

Get an API key

Free tier, no form to fill in. Signing in shares your email address with us — we store it to create your key and to recognise you if you sign in with another provider. See our Privacy Policy and Terms.

A second provider on the same verified email joins the account you already have.