DeleteServiceSpecificCredentialRequest

APIs.ioEngineeringPlatform

Properties

Name Type Description
UserName object
ServiceSpecificCredentialId object
View JSON Schema on GitHub

JSON Schema

apis-io-engineering-platform-deleteservicespecificcredentialrequest-schema.json Raw ↑
{
  "$schema": "https://json-schema.org/draft/2020-12/schema",
  "$id": "#/components/schemas/DeleteServiceSpecificCredentialRequest",
  "title": "DeleteServiceSpecificCredentialRequest",
  "type": "object",
  "required": [
    "ServiceSpecificCredentialId"
  ],
  "properties": {
    "UserName": {
      "allOf": [
        {
          "$ref": "#/components/schemas/userNameType"
        },
        {
          "description": "<p>The name of the IAM user associated with the service-specific credential. If this value is not specified, then the operation assumes the user whose credentials are used to call the operation.</p> <p>This parameter allows (through its <a href=\"http://wikipedia.org/wiki/regex\">regex pattern</a>) a string of characters consisting of upper and lowercase alphanumeric characters with no spaces. You can also include any of the following characters: _+=,.@-</p>"
        }
      ]
    },
    "ServiceSpecificCredentialId": {
      "allOf": [
        {
          "$ref": "#/components/schemas/serviceSpecificCredentialId"
        },
        {
          "description": "<p>The unique identifier of the service-specific credential. You can get this value by calling <a>ListServiceSpecificCredentials</a>.</p> <p>This parameter allows (through its <a href=\"http://wikipedia.org/wiki/regex\">regex pattern</a>) a string of characters that can consist of any upper or lowercased letter or digit.</p>"
        }
      ]
    }
  }
}

Work with this as data

Every JSON Schema here is available over the APIs.io API and to AI agents over MCP.

MCP server

One button, every client — Claude, Cursor, VS Code and the rest.

https://apis.io/mcp

Tools for schemas

4 MCP tools reach this
  • find_json_schemasBrowse and filter every JSON Schema in the catalog.
  • apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.
  • resolveTurn a domain, URL or GitHub org into the provider it belongs to.
  • find_cohortsEvery scored population of providers in the catalog.
All 92 tools →

Call it yourself

curl for this page
This JSON Schema
curl "https://apis.io/api/v1/json-schemas/apis-io-engineering-platform-deleteservicespecificcredentialrequest"
All schemas
curl "https://apis.io/api/v1/json-schemas?limit=25"

Discovery needs no key. Ratings and market analysis are Pro.

Get an API key

Free tier, no form to fill in. Signing in shares your email address with us — we store it to create your key and to recognise you if you sign in with another provider. See our Privacy Policy and Terms.

A second provider on the same verified email joins the account you already have.