Wikimedia · Example Payload

Page Summary

German-born theoretical physicist (1879–1955)

WikipediaWikimediaEncyclopediaOpen KnowledgeContentSearchReference

Page Summary is an example object payload from Wikimedia, with 18 top-level fields. It illustrates the shape of data this provider's APIs accept or return.

Top-level fields

titledisplaytitlenamespacewikibase_itemtitlespageidthumbnailoriginalimagelangdirrevisiontidtimestampdescriptiondescription_sourcecontent_urlsextractextract_html

Example Payload

{
  "title": "Albert Einstein",
  "displaytitle": "<span>Albert Einstein</span>",
  "namespace": {
    "id": 0,
    "text": ""
  },
  "wikibase_item": "Q937",
  "titles": {
    "canonical": "Albert_Einstein",
    "normalized": "Albert Einstein",
    "display": "<span>Albert Einstein</span>"
  },
  "pageid": 736,
  "thumbnail": {
    "source": "https://upload.wikimedia.org/wikipedia/commons/thumb/d/d3/Albert_Einstein_Head.jpg/320px-Albert_Einstein_Head.jpg",
    "width": 320,
    "height": 417
  },
  "originalimage": {
    "source": "https://upload.wikimedia.org/wikipedia/commons/d/d3/Albert_Einstein_Head.jpg",
    "width": 800,
    "height": 1041
  },
  "lang": "en",
  "dir": "ltr",
  "revision": "1234567890",
  "tid": "12345678-1234-1234-1234-123456789012",
  "timestamp": "2024-01-15T12:00:00Z",
  "description": "German-born theoretical physicist (1879\u20131955)",
  "description_source": "local",
  "content_urls": {
    "page": {
      "desktop": {
        "page": "https://en.wikipedia.org/wiki/Albert_Einstein"
      }
    },
    "mobile": {
      "page": "https://en.m.wikipedia.org/wiki/Albert_Einstein"
    }
  },
  "extract": "Albert Einstein was a German-born theoretical physicist who is best known for developing the theory of relativity.",
  "extract_html": "<p>Albert Einstein was a German-born theoretical physicist...</p>"
}

Work with this as data

Every example here is available over the APIs.io API and to AI agents over MCP.

MCP server

One button, every client — Claude, Cursor, VS Code and the rest.

https://apis.io/mcp

Tools for examples

4 MCP tools reach this

find_examplesBrowse and filter every example in the catalog.
apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.
resolveTurn a domain, URL or GitHub org into the provider it belongs to.
find_cohortsEvery scored population of providers in the catalog.

All 92 tools

Call it yourself

curl for this page

This example

curl "https://apis.io/api/v1/examples/page-summary"

All examples

curl "https://apis.io/api/v1/examples?limit=25"

Discovery needs no key. Ratings and market analysis are Pro.

Get an API key

Free tier, no email required.

GitHub Google LinkedIn

A second provider on the same verified email joins the account you already have.