Wikimedia · Example Payload
Page Summary
German-born theoretical physicist (1879–1955)
WikipediaWikimediaEncyclopediaOpen KnowledgeContentSearchReference
Page Summary is an example object payload from Wikimedia, with 18 top-level fields. It illustrates the shape of data this provider's APIs accept or return.
Top-level fields
titledisplaytitlenamespacewikibase_itemtitlespageidthumbnailoriginalimagelangdirrevisiontidtimestampdescriptiondescription_sourcecontent_urlsextractextract_html
Example Payload
Work with this as data
Every example here is available over the APIs.io API and to AI agents over MCP.
MCP server
One button, every client — Claude, Cursor, VS Code and the rest.
https://apis.io/mcp
Tools for examples
4 MCP tools reach this
find_examplesBrowse and filter every example in the catalog.apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.resolveTurn a domain, URL or GitHub org into the provider it belongs to.find_cohortsEvery scored population of providers in the catalog.
Call it yourself
curl for this page
This example
curl "https://apis.io/api/v1/examples/page-summary"
All examples
curl "https://apis.io/api/v1/examples?limit=25"
Discovery needs no key. Ratings and market analysis are Pro.