EvolutionaryScale · Example Payload

Evolutionaryscale Forge Generate Example

Artificial IntelligenceBiologyBioinformaticsComputational BiologyDrug DiscoveryESMESM3ESM CambrianFoundation ModelsGenerative BiologyLife SciencesMachine-LearningProtein DesignProtein FoldingProtein Language ModelsProteinsRepresentation LearningStructure Prediction

Evolutionaryscale Forge Generate Example is an example object payload from EvolutionaryScale, with 2 top-level fields. It illustrates the shape of data this provider's APIs accept or return.

Top-level fields

requestresponse

Example Payload

Raw ↑ 
{
  "request": {
    "url": "https://forge.evolutionaryscale.ai/api/v1/generate",
    "method": "POST",
    "headers": {
      "authorization": "Bearer <FORGE_API_TOKEN>",
      "content-type": "application/json"
    },
    "body": {
      "model": "esm3-medium-2024-08",
      "protein": {
        "sequence": "MKTAYIAKQRQISFVK_____SSERVKKLLVGDIVT"
      },
      "config": {
        "track": "sequence",
        "num_steps": 8,
        "temperature": 1.0
      }
    }
  },
  "response": {
    "status": 200,
    "body": {
      "sequence": "MKTAYIAKQRQISFVKAHFSRSSERVKKLLVGDIVT",
      "plddt": null,
      "ptm": null
    }
  }
}