EvolutionaryScale · Example Payload

Evolutionaryscale Forge Fold Example

AIArtificial IntelligenceBiologyBioinformaticsComputational BiologyDrug DiscoveryESMESM3ESM CambrianFoundation ModelsGenerative BiologyLife SciencesMachine LearningProtein DesignProtein FoldingProtein Language ModelsProteinsRepresentation LearningStructure Prediction

Evolutionaryscale Forge Fold Example is an example object payload from EvolutionaryScale, with 2 top-level fields. It illustrates the shape of data this provider's APIs accept or return.

Top-level fields

requestresponse

Example Payload

Raw ↑
{
  "request": {
    "url": "https://forge.evolutionaryscale.ai/api/v1/fold",
    "method": "POST",
    "headers": {
      "authorization": "Bearer <FORGE_API_TOKEN>",
      "content-type": "application/json"
    },
    "body": {
      "model": "esm3-medium-2024-08",
      "sequence": "MKTAYIAKQRQISFVKAHFSRQLEERLGLIEVQ",
      "num_recycles": 3
    }
  },
  "response": {
    "status": 200,
    "body": {
      "sequence": "MKTAYIAKQRQISFVKAHFSRQLEERLGLIEVQ",
      "coordinates": [
        [[12.345, 5.678, 9.012], "...37 atom entries per residue..."]
      ],
      "plddt": [82.1, 86.4, 90.0, "..."],
      "ptm": 0.78
    }
  }
}