EvolutionaryScale · Example Payload

Evolutionaryscale Forge Fold Example

Artificial IntelligenceBiologyBioinformaticsComputational BiologyDrug DiscoveryESMESM3ESM CambrianFoundation ModelsGenerative BiologyLife SciencesMachine-LearningProtein DesignProtein FoldingProtein Language ModelsProteinsRepresentation LearningStructure Prediction

Evolutionaryscale Forge Fold Example is an example object payload from EvolutionaryScale, with 2 top-level fields. It illustrates the shape of data this provider's APIs accept or return.

Top-level fields

requestresponse

Example Payload

Raw ↑
{
  "request": {
    "url": "https://forge.evolutionaryscale.ai/api/v1/fold",
    "method": "POST",
    "headers": {
      "authorization": "Bearer <FORGE_API_TOKEN>",
      "content-type": "application/json"
    },
    "body": {
      "model": "esm3-medium-2024-08",
      "sequence": "MKTAYIAKQRQISFVKAHFSRQLEERLGLIEVQ",
      "num_recycles": 3
    }
  },
  "response": {
    "status": 200,
    "body": {
      "sequence": "MKTAYIAKQRQISFVKAHFSRQLEERLGLIEVQ",
      "coordinates": [
        [[12.345, 5.678, 9.012], "...37 atom entries per residue..."]
      ],
      "plddt": [82.1, 86.4, 90.0, "..."],
      "ptm": 0.78
    }
  }
}

Work with this as data

Every example here is available over the APIs.io API and to AI agents over MCP.

MCP server

One button, every client — Claude, Cursor, VS Code and the rest.

https://apis.io/mcp

Tools for examples

4 MCP tools reach this
  • find_examplesBrowse and filter every example in the catalog.
  • apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.
  • resolveTurn a domain, URL or GitHub org into the provider it belongs to.
  • find_cohortsEvery scored population of providers in the catalog.
All 92 tools →

Call it yourself

curl for this page
This example
curl "https://apis.io/api/v1/examples/evolutionaryscale-forge-fold-example"
All examples
curl "https://apis.io/api/v1/examples?limit=25"

Discovery needs no key. Ratings and market analysis are Pro.

Get an API key

Free tier, no form to fill in. Signing in shares your email address with us — we store it to create your key and to recognise you if you sign in with another provider. See our Privacy Policy and Terms.

A second provider on the same verified email joins the account you already have.