EvolutionaryScale · Example Payload

Evolutionaryscale Forge Fold Example

Artificial IntelligenceBiologyBioinformaticsComputational BiologyDrug DiscoveryESMESM3ESM CambrianFoundation ModelsGenerative BiologyLife SciencesMachine-LearningProtein DesignProtein FoldingProtein Language ModelsProteinsRepresentation LearningStructure Prediction

Evolutionaryscale Forge Fold Example is an example object payload from EvolutionaryScale, with 2 top-level fields. It illustrates the shape of data this provider's APIs accept or return.

Top-level fields

requestresponse

Example Payload

Raw ↑ 
{
  "request": {
    "url": "https://forge.evolutionaryscale.ai/api/v1/fold",
    "method": "POST",
    "headers": {
      "authorization": "Bearer <FORGE_API_TOKEN>",
      "content-type": "application/json"
    },
    "body": {
      "model": "esm3-medium-2024-08",
      "sequence": "MKTAYIAKQRQISFVKAHFSRQLEERLGLIEVQ",
      "num_recycles": 3
    }
  },
  "response": {
    "status": 200,
    "body": {
      "sequence": "MKTAYIAKQRQISFVKAHFSRQLEERLGLIEVQ",
      "coordinates": [
        [[12.345, 5.678, 9.012], "...37 atom entries per residue..."]
      ],
      "plddt": [82.1, 86.4, 90.0, "..."],
      "ptm": 0.78
    }
  }
}