Censys · Example Payload

Asset Graph Vuln Example

SecurityInternet IntelligenceAttack Surface ManagementThreat Huntingcyber-threat-intelligenceOSINTInternet ScanningCertificatesAsset Discovery

Asset Graph Vuln Example is an example object payload from Censys, with 11 top-level fields. It illustrates the shape of data this provider's APIs accept or return.

Top-level fields

confidencecwesevidenceidkevmetricsnamerisk_sourceseveritysourceyear

Example Payload

Raw ↑
{
  "confidence": 63.64,
  "cwes": [
    null,
    null
  ],
  "evidence": [
    null,
    null
  ],
  "id": "01234567-89ab-cdef-0123-456789abcdef",
  "kev": [
    null,
    null
  ],
  "metrics": null,
  "name": "Production Internet Asset Inventory",
  "risk_source": "censys",
  "severity": "high",
  "source": "html_meta_extractor",
  "year": 436
}

Work with this as data

Every example here is available over the APIs.io API and to AI agents over MCP.

MCP server

One button, every client — Claude, Cursor, VS Code and the rest.

https://apis.io/mcp

Tools for examples

4 MCP tools reach this
  • find_examplesBrowse and filter every example in the catalog.
  • apis_io_searchSTART HERE — APIs, providers and tags for one query, each with its total.
  • resolveTurn a domain, URL or GitHub org into the provider it belongs to.
  • find_cohortsEvery scored population of providers in the catalog.
All 92 tools →

Call it yourself

curl for this page
This example
curl "https://apis.io/api/v1/examples/asset-graph-vuln-example"
All examples
curl "https://apis.io/api/v1/examples?limit=25"

Discovery needs no key. Ratings and market analysis are Pro.

Get an API key

Free tier, no form to fill in. Signing in shares your email address with us — we store it to create your key and to recognise you if you sign in with another provider. See our Privacy Policy and Terms.

A second provider on the same verified email joins the account you already have.